PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 223aa    MW: 25130.6 Da    PI: 4.8755
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056269genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.61.2e-232076258
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                  WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
                          +Dg +WrKYGqK + g ++pr YYrC  + C+++k v+r +++p ++e+tY g+H +
  PGSC0003DMP400056269 20 EDGLSWRKYGQKLILGEKYPREYYRCPRRCCEATKMVQRIETEPLTFEVTYGGSHSC 76
                          7******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.9E-24878IPR003657WRKY domain
PROSITE profilePS5081119.2671475IPR003657WRKY domain
SuperFamilySSF1182903.14E-221778IPR003657WRKY domain
SMARTSM007741.3E-241978IPR003657WRKY domain
PfamPF031064.8E-222076IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MLARRKEYVE ARPGEEVPPE DGLSWRKYGQ KLILGEKYPR EYYRCPRRCC EATKMVQRIE  60
TEPLTFEVTY GGSHSCGQET KNQNEELIAV QQTKCDEVGR GAGQIFESYI HKMVSTPNNS  120
YNNSSTGVEF SNSNSVFNIP NSDFIPTPTS SPHPDMDFPF DYSSFTHLFG QDVPDNSGND  180
SLAALAAEVY KLYEENGKLN FPHRYDKQAE NSRPSNNVGD QS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345566.11e-168PREDICTED: probable WRKY transcription factor 41
TrEMBLM1D7L21e-168M1D7L2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000842141e-167(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11070.26e-13WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]